PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV14406.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ZF-HD
Protein Properties Length: 87aa    MW: 9564.74 Da    PI: 8.0518
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV14406.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.21.7e-322379360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAa++Gg+avDGC+Efm++ geegt aa+ CaACgCHRnFHRreve+e
   KZV14406.1 23 TVRYAECQKNHAANIGGYAVDGCREFMAA-GEEGTGAAFSCAACGCHRNFHRREVETE 79
                 79**************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-26286IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-292476IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.9E-262576IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.522675IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MKRQIVVRKE ASQRTCSSQI VRTVRYAECQ KNHAANIGGY AVDGCREFMA AGEEGTGAAF  60
SCAACGCHRN FHRREVETEV VCDSSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032530.11e-41Mini zinc finger 2 isoform 1
RefseqXP_010037168.11e-41PREDICTED: mini zinc finger protein 3-like
SwissprotQ9LJW51e-35MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A059A5781e-41A0A059A578_EUCGR; Uncharacterized protein
TrEMBLA0A061EEU82e-41A0A061EEU8_THECC; Mini zinc finger 2 isoform 1
STRINGPOPTR_0004s12510.12e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.18e-37mini zinc finger 2